PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11419_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 268aa    MW: 30257 Da    PI: 4.7773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11419_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.7e-161461148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
  cra_locus_11419_iso_1_len_1204_ver_3 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                                          79********************************************97 PP

2Myb_DNA-binding53.84.4e-1770111447
                                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                            T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  cra_locus_11419_iso_1_len_1204_ver_3  70 LTESEEQLVIDLHARLGNR-WSKIASRLP-GRTDNEIKNHWNTH 111
                                           69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.027961IPR017930Myb domain
SuperFamilySSF466892.77E-2711108IPR009057Homeodomain-like
SMARTSM007178.5E-131363IPR001005SANT/Myb domain
PfamPF002498.2E-151461IPR001005SANT/Myb domain
CDDcd001672.31E-91661No hitNo description
PROSITE profilePS5129427.31762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-2564116IPR009057Homeodomain-like
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002492.3E-1569111IPR001005SANT/Myb domain
CDDcd001671.94E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL TESEEQLVID LHARLGNRWS KIASRLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPVTHEPLQ KETNEEKPDP SPEPEKNNQP AAHEIITNGG SSSTTSEDQN SSTDESSNLL  180
LDNTNIILDN VTDCDPLMMN YLLGDELAAW DDPFPISGGT GQNFENILDD TCSWLMDCQD  240
FGVHDYSFND VEISNVMNSL EMAVENKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069675.11e-113PREDICTED: protein ODORANT1
SwissprotQ50EX61e-102ODO1_PETHY; Protein ODORANT1
TrEMBLA0A068UQK71e-126A0A068UQK7_COFCA; Uncharacterized protein
STRINGVIT_00s1241g00010.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154